PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000119725
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 403aa    MW: 44022.3 Da    PI: 4.3905
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000119725genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +grWT+eEde+l+++++  G g+W++ ++  g+ R++k+c++rw +yl
    MDP0000119725 14 KGRWTAEEDEILLNYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding48.71.7e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + +E+++++++++ lG++ W++Ia+ ++ gRt++++k++w+++l
    MDP0000119725  67 RGNISSQEEDIIIKLHASLGNR-WSLIASQLP-GRTDNEIKNYWNSHL 112
                      78999*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.7E-22564IPR009057Homeodomain-like
PROSITE profilePS5129416.625961IPR017930Myb domain
SuperFamilySSF466899.18E-2811108IPR009057Homeodomain-like
SMARTSM007173.0E-121363IPR001005SANT/Myb domain
PfamPF002491.4E-141461IPR001005SANT/Myb domain
CDDcd001675.41E-101661No hitNo description
PROSITE profilePS5129424.50762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.5E-2465116IPR009057Homeodomain-like
SMARTSM007174.4E-1566114IPR001005SANT/Myb domain
PfamPF002499.1E-1467112IPR001005SANT/Myb domain
CDDcd001671.32E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MGRAPCCEKV GLKKGRWTAE EDEILLNYIQ ANGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LRADLKRGNI SSQEEDIIIK LHASLGNRWS LIASQLPGRT DNEIKNYWNS HLSRKIGTFR  120
RPATTTVITT EISTSSPPAG DEDGYVLLME VPDQQQETRG GGIAMPATVI DHQKETDGEK  180
LILGPHPHGH DDDDMNEYVG INGGLLGFTD YLMDDINEDE ILDPNGVMAL SSSEINIHQD  240
ADHFPDAVIS DHQDTELPSS CDQLVICPNK VMTTTTTTAS SDDHHDQELE SSSCGCNLSS  300
SSSISNSNGK VVTGDLHSCG SSLSLTNTSN CDTEDGHTAG GFGNHDQILW DWESVLSNAG  360
TGHDYLWDGH DRQNMLSWLR EGESATAAGD DDHADAMVAW LLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-24121162105C-Myb DNA-Binding Domain
1msf_C1e-24121162105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.144810.0bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744700.0DQ074470.1 Malus x domestica MYB22 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008369060.11e-163PREDICTED: uncharacterized protein LOC103432638
TrEMBLA0A0N7EZN11e-148A0A0N7EZN1_PYRPY; MYB12
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.11e-70myb domain protein 111